Welcome to Our Company
PeptiCore is a global manufacturer and supplier of peptides and pharmaceutical raw materials in the chemical industry.
Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.
I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.
Welcome to Our Company
OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Appearance: Powder
Purity: >99% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
Quality First Safety Guaranteed

Send a Message
We'd love to hear from you if you have any questions!